Protein Info for Psest_3876 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 18 to 37 (20 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 236 to 264 (29 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 310 to 336 (27 residues), see Phobius details PF01594: AI-2E_transport" amino acids 23 to 336 (314 residues), 176.3 bits, see alignment E=4.8e-56

Best Hits

KEGG orthology group: None (inferred from 88% identity to psa:PST_0396)

Predicted SEED Role

"protein of unknown function UPF0118"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQR7 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Psest_3876 Predicted permease (Pseudomonas stutzeri RCH2)
MSTPTSQNDAKKLANRAMVQAAVLAAVVLFCIVAWLAFDFLLLLFASILFGVLIHGVSQW
ISDHTSMPYKAAMPAFFVVMLLALGGGGWWVAPNIAEQADALSDSLPQAVEQLRERAEQL
PWANELMQQGDRLEDSLPDGSSAFSVVTKVMGSVAGALSSFVIAFAIGICLAINPQIYVR
GLLKLVPLGYRPRAGEILDESGATLRAWLLAKLLEMLLIGVLTTLGLWLLGIELALVLGL
IAGLLSFIPNIGPVLAVIPALLLASLEGGRTVLYVAGLYLFVQALESYVFTPLMQQRIVS
IPPALTIAVQLLFGLLAGTLGLLLATPLAAVGMVLVRMLYVEDLLGDRSDATDGSSP