Protein Info for HP15_3743 in Marinobacter adhaerens HP15

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00460: methionyl-tRNA formyltransferase" amino acids 1 to 303 (303 residues), 322.9 bits, see alignment E=1e-100 PF00551: Formyl_trans_N" amino acids 1 to 180 (180 residues), 174.8 bits, see alignment E=1.5e-55 PF02911: Formyl_trans_C" amino acids 203 to 299 (97 residues), 99 bits, see alignment E=1.5e-32

Best Hits

Swiss-Prot: 77% identical to FMT_MARHV: Methionyl-tRNA formyltransferase (fmt) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 77% identity to maq:Maqu_0042)

MetaCyc: 53% identical to 10-formyltetrahydrofolate:L-methionyl-tRNAfMet N-formyltransferase (Escherichia coli K-12 substr. MG1655)
Methionyl-tRNA formyltransferase. [EC: 2.1.2.9]; 2.1.2.9 [EC: 2.1.2.9]

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI21 at UniProt or InterPro

Protein Sequence (311 amino acids)

>HP15_3743 methionyl-tRNA formyltransferase (Marinobacter adhaerens HP15)
MRLVFAGTPDFAATALRALIAAGHTIVGVYSQPDRPAGRGRKLQPSPVKQVALDHGIQVF
QPETLKTPDAQKQLADLNPDVMIVAAYGLILPKAVLDIPTHGCLNIHASLLPRWRGAAPI
QRAIAAGDAETGITIMQMDEGLDTGAMLLKSLTTIEDNDTGGSLHDRLAELGGQAIIKAL
ELLKKGELTGEPQNDQLACYASKLSKTEGHIDWAADATAIERLVRAFNPWPGTYTDLGDQ
RIRIHEAQALVTASDAFPGTVVQRDRDGIDIACGNGTLRITRLQLPGSRAQSVNDLINGG
KELLMPGQELR