Protein Info for PGA1_c03910 in Phaeobacter inhibens DSM 17395

Annotation: short chain dehydrogenase / reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF08659: KR" amino acids 11 to 175 (165 residues), 38 bits, see alignment E=4.9e-13 PF00106: adh_short" amino acids 11 to 200 (190 residues), 165 bits, see alignment E=4.6e-52 PF01370: Epimerase" amino acids 12 to 91 (80 residues), 26.2 bits, see alignment E=1.5e-09 PF13561: adh_short_C2" amino acids 16 to 228 (213 residues), 131.8 bits, see alignment E=9.3e-42 PF13460: NAD_binding_10" amino acids 16 to 74 (59 residues), 33.1 bits, see alignment E=1.6e-11 PF08643: DUF1776" amino acids 86 to 189 (104 residues), 27.5 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: None (inferred from 77% identity to sit:TM1040_3100)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWD1 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PGA1_c03910 short chain dehydrogenase / reductase (Phaeobacter inhibens DSM 17395)
MSAEDQVSKRTILITGASSGIGRAVAELFLEEGWQVGLLARRAEQLEEVAQDRDTAHVLP
ADVTDPGAVDHAFDCFAKRVGRLDVLFNNAGIFTPSGTIDEIELEDWFAAVNVNLNGMFL
TARAAFRQMRQQSPQGGRIINNGSIAAHVPRTGSAPYAATKSAITGLTRSLSLDGRPFQI
ACGQIDIGNARTPMVEDLSARQVSADPSAVPMQTFAVEDAAQSVLHMADLPLEANVQFMT
IMATTMPYIGRG