Protein Info for Psest_3863 in Pseudomonas stutzeri RCH2

Annotation: NTP pyrophosphohydrolases including oxidative damage repair enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 7 to 145 (139 residues), 80.8 bits, E=4.9e-27

Best Hits

Swiss-Prot: 99% identical to RPPH_PSEU5: RNA pyrophosphohydrolase (rppH) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 99% identity to psa:PST_0409)

MetaCyc: 65% identical to RNA pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; 3.6.1.-

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

See L0GNK5 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Psest_3863 NTP pyrophosphohydrolases including oxidative damage repair enzymes (Pseudomonas stutzeri RCH2)
MIDSDGFRPNVGIILTNDVGQVLWARRINQDAWQFPQGGINARETPEEALFRELNEEVGL
EEQDVKILACTRGWLRYRLPQRLVRTHSQPLCIGQKQKWFLLRLTSAEERVRMDLTGKPE
FDGWRWVSYWYPLGQVVTFKREVYRRALKELAPRLPVRD