Protein Info for Psest_3860 in Pseudomonas stutzeri RCH2

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 6 to 34 (29 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 176 to 199 (24 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details PF01925: TauE" amino acids 7 to 257 (251 residues), 192 bits, see alignment E=6.7e-61

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 95% identity to psa:PST_0412)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSH5 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Psest_3860 Predicted permeases (Pseudomonas stutzeri RCH2)
MEFLLYLLLGGFAGVLAGLFGVGGGLIIVPVLVFSFSAQGFSADILTHLAVGTSLATIVF
TSINSILTHHRKGAVRWPTVLWMTFGILVGAALGSLTAAAIQGPMLQKIIGVFALAMAVQ
MGFDLRPKATGRAPGRPELSLVGVVIGWASAIFGIGGGSLSVPYLTWRSVPMQQAVATSA
ACGLPIAIAGALSFMVVGWHETQLPDWSLGFVYLPAMLGIAATSMFFARLGAKLAHRLSA
KVLKRLFALLLLSVGINFLV