Protein Info for Psest_3859 in Pseudomonas stutzeri RCH2

Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 229 to 255 (27 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 4 to 260 (257 residues), 276.8 bits, see alignment E=1e-86 PF01790: LGT" amino acids 9 to 255 (247 residues), 288 bits, see alignment E=2.6e-90

Best Hits

Swiss-Prot: 99% identical to LGT_PSEU5: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 99% identity to psa:PST_0413)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSP5 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Psest_3859 prolipoprotein diacylglyceryl transferase (Pseudomonas stutzeri RCH2)
MLPYPQIDPVAIAIGPLQIHWYGLMYLIGIGGAWWLASLRVQRFAPEWPKDKLSDLVFWV
AMGVIVGGRLGYVLFYDLAAYLNQPSLILQVWKGGMSFHGGLIGVLLCSWIFARRNGKSF
FELMDFIAPFVPIGLGAGRIGNFINAELWGKATDVPWAMVFPTDPQQLARHPSQLYQFAL
EGVALFVILWLYSRKPRPTMAVSGLFAVCYGIFRFIVEFVRVPDAQLGYLAFGWLTMGQV
LCVPMVLLGAGMIAWGYRRDAGRAPA