Protein Info for Psest_3858 in Pseudomonas stutzeri RCH2

Annotation: thymidylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00303: Thymidylat_synt
  • amino acids 2 to 264 (263 residues), 427.5 bits, E=8.5e-133
• TIGR03284: thymidylate synthase
  • amino acids 2 to 85 (84 residues), 141.3 bits, E=1.8e-45
  • amino acids 84 to 264 (181 residues), 320 bits, E=6.8e-100

Best Hits

Swiss-Prot: 98% identical to TYSY_PSEU5: Thymidylate synthase (thyA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 98% identity to psa:PST_0414)

MetaCyc: 69% identical to thymidylate synthase (Escherichia coli K-12 substr. MG1655)
Thymidylate synthase. [EC: 2.1.1.45]

Predicted SEED Role

"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• folate transformations III (E. coli) (9/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• folate transformations II (plants) (10/11 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
• pyrimidine deoxyribonucleosides salvage (1/5 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.45

Sequence Analysis Tools

See L0GNJ9 at UniProt or InterPro

Protein Sequence (264 amino acids)

>Psest_3858 thymidylate synthase (Pseudomonas stutzeri RCH2)
MKQYLDLMRHVREHGTFKTDRTGTGTYSVFGHQMRFDLAEGFPLVTTKKCHLKSIIHELL
WFLQGDTNIKYLKENGVRIWDEWADENGELGPVYGYQWRSWPAPNGESIDQISNLLAMIK
KNPDSRRLIVSAWNPALVEQMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIAS
YALLTLMVAQVCDLQPGEFIWSGGDCHLYANHLEQADLQLTREPLPLPTMQLNPQVKDLF
AFRFEDFELVGYEAHPHIKAPVAV