Protein Info for Psest_3855 in Pseudomonas stutzeri RCH2

Annotation: Branched-chain amino acid ABC-type transport system, permease components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 230 to 257 (28 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 17 to 283 (267 residues), 138.8 bits, see alignment E=9.7e-45

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to psa:PST_0417)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSG9 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Psest_3855 Branched-chain amino acid ABC-type transport system, permease components (Pseudomonas stutzeri RCH2)
MTTIFDVPIQAFLGQLLIGLINGSFYAMLSLGLAIIFGMLKIINFAHGAQYMIGAFAGYL
LLATLGIGYWPALILAPIIVGLCSAVIERLALSRLYNLDHLYSLLFTFGLALALEGAFRY
FYGSSGQPYAVPKELAGGYNLGFMFLPKYRAWVVLASLVICIASWLLIEKTKLGAYLRAA
TENPTLVRTFGINVPLLLTFTYGMGAALAGLAGMLAAPIYQVSPLMGSNLIIVVFAVVVV
GGMGSILGAIITGYMLGILEGLTKVFYPEASNIVIFVIMAIVLLVRPAGLMGRDA