Protein Info for HP15_3724 in Marinobacter adhaerens HP15

Annotation: 1-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR03168: hexose kinase, 1-phosphofructokinase family" amino acids 4 to 308 (305 residues), 304 bits, see alignment E=9.5e-95 TIGR03828: 1-phosphofructokinase" amino acids 4 to 307 (304 residues), 297.8 bits, see alignment E=7.5e-93 PF00294: PfkB" amino acids 24 to 293 (270 residues), 168.9 bits, see alignment E=8.5e-54

Best Hits

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 51% identity to csa:Csal_2647)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI02 at UniProt or InterPro

Protein Sequence (321 amino acids)

>HP15_3724 1-phosphofructokinase (Marinobacter adhaerens HP15)
MARILTITLNPALDLSVETAPLALGEVNRTGHTLMEPAGKGINVARVLARLGHSVTVAGL
LGDANAAPFERLFEAEGLQDSFVRVPGQNRNNIKIAEAGGRVTDLNGPGFRAPEDALQRL
QLRLKSLLPECDAVVIGGSLPDGFPPSGLAILVEQASRADKPVWLDTSGAGLKAGIKAGP
YAIKPNTDELSDWAGTPLKDLASVAATVDGIRAGGVSHVVVSMGADGVFWSSPAGILRSR
VPPVSLVSTVCAGDTLLAGMLHGVLGEQSEDTVLAFATALSAECVQHIGVGDPGAPDFHS
LLQQTRVQPWPWQNNTGEIRL