Protein Info for PGA1_262p01840 in Phaeobacter inhibens DSM 17395

Annotation: ATP-dependent AMP binding enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 543 PF00501: AMP-binding" amino acids 29 to 404 (376 residues), 253.9 bits, see alignment E=2.3e-79 PF13193: AMP-binding_C" amino acids 454 to 528 (75 residues), 79.4 bits, see alignment E=3.2e-26

Best Hits

KEGG orthology group: K00666, fatty-acyl-CoA synthase [EC: 6.2.1.-] (inferred from 64% identity to mlo:mlr6974)

Predicted SEED Role

"3-methylmercaptopropionyl-CoA ligase (DmdB)"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.-

Use Curated BLAST to search for 6.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F4S3 at UniProt or InterPro

Protein Sequence (543 amino acids)

>PGA1_262p01840 ATP-dependent AMP binding enzyme (Phaeobacter inhibens DSM 17395)
MQKNYEKFGKVAANYVPLSPVSFLNRAETLHSDRPAVIYGDLRRTWGEVATRIRGVAAGL
VSLGIGRGDTVSVLCPNIPELFELQFALPLTGAVINTLNTRLEPETIAYILDHADTKAVI
VDRELIPLLSMAFAAMGRSVSVIEIDDRNVAAPHTLVGKPYEELLTDGAGGAPLDLPQDE
WDAIALNYTSGTSGRPKGVVYHHRGAYLMALGTAAAWQTPHYPIYLSVVPMFHCNGWGHS
WVMAMLGGTMVFTRTPSPDLILDAIRSHGVTHFGAAPIVLQMLAEAEAETGSTTPFDPAI
KVLTAGAPPPPSVLQKTKAMGLDVMQVYGLTETYGHISKCLWQDSWADKIEAEQAQLQAQ
QGIAMPMVEAVSVIDTDTGIPVARDGQTQGEIAVRGNTVMKGYYKDADATDKAFENGWFW
SGDGAVVHADGYMQIRDRLKDVIISGGENISSVEVEAVLYRHPAVQAAAVVAKPDPKWGE
VPCAFIELRTGSDLTSEEIIAFCRTHLAGFKAPKTVVFTSLPKTSTGKIQKFQLRDAAKT
MST