Protein Info for PGA1_262p01770 in Phaeobacter inhibens DSM 17395

Annotation: putative endoribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF01042: Ribonuc_L-PSP" amino acids 3 to 110 (108 residues), 82.6 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 43% identical to YOAB_ECOL6: RutC family protein YoaB (yoaB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 86% identity to dsh:Dshi_3201)

Predicted SEED Role

"RidA/YER057c/UK114 superfamily, group 2, YoaB-like protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESW5 at UniProt or InterPro

Protein Sequence (113 amino acids)

>PGA1_262p01770 putative endoribonuclease (Phaeobacter inhibens DSM 17395)
MIERIDTGTRSSKIVKHNGVVYLTGQVAEGDTIQAQVKTCLDNVDALLSKAGSSREDMLR
VTIWLADMSDFDGLNEVWNAWVPAGHAPARACGEAKLARPELKVEFIVDAAYS