Protein Info for HP15_3710 in Marinobacter adhaerens HP15

Annotation: ABC transporter, ATP-binding/permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 transmembrane" amino acids 34 to 58 (25 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 148 to 173 (26 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 260 to 283 (24 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 35 to 309 (275 residues), 141 bits, see alignment E=6.3e-45 PF00005: ABC_tran" amino acids 372 to 521 (150 residues), 118.5 bits, see alignment E=3.6e-38

Best Hits

Swiss-Prot: 48% identical to ABCB5_DICDI: ABC transporter B family member 5 (abcB5) from Dictyostelium discoideum

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 90% identity to maq:Maqu_0009)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHH3 at UniProt or InterPro

Protein Sequence (605 amino acids)

>HP15_3710 ABC transporter, ATP-binding/permease protein (Marinobacter adhaerens HP15)
MRAYADNDYPADHKPDWKIISGLWPYLAEFRGRVVLSLVLLVLAKLATVATPIALKYIVD
YLDQNRGADMLLWIPVILVVAYGTLRFGATLFNELRDAVFARVAERAMRRVSLRVFEHLH
QRELAFHLDRKTGGLARDIERGTNGISFLLRFTLFNIVPTLLEILMVAGILFVVFNVGYV
LAILVAVVVYVVFSIKITEWRTKFVREANARDNQSNSRAIDSLLNYETVKYFNNERYEAE
VYDRDLDDWEQARLKNRLSLAALNSGQALIIGLAMIVIMAMAVREVASGEITLGDFTMIN
AYLLQLFIPLNALGFVYREIRQALVNVERLFKLLGDKPAIEDAPDATELAVDRGEVQFDH
IHFAYRPDRPILKDVNFSIPSGHKIAVVGASGAGKSTLARLLFRFYDVDQGAIRIDGQDI
RQVTQDSLRSAIGVVPQDTVLFNDTLYRNLAYGRPEATEEEVYRAARMAHLEDFIHSLPE
GYETKVGERGLKLSGGEKQRVAIARVILKNPPLLILDEATSSLDSLSEQAILTALKEVSQ
RRTTLVIAHRLSTVMDADSILVMEGGKIVESGHHQDLLARNGHYARLWFQQHQSDGGDTE
IQPES