Protein Info for Psest_3829 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyl-CoA transferases/carnitine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 46% identical to SUCHY_HUMAN: Succinate--hydroxymethylglutarate CoA-transferase (SUGCT) from Homo sapiens

KEGG orthology group: None (inferred from 98% identity to psa:PST_0443)

MetaCyc: 77% identical to succinyl-CoA-glutarate CoA-transferase (Pseudomonas putida)
Succinate--hydroxymethylglutarate CoA-transferase. [EC: 2.8.3.13]

Predicted SEED Role

"L-carnitine dehydratase/bile acid-inducible protein F"

MetaCyc Pathways

L-lysine degradation X (5/6 steps found)
L-lysine degradation IV (3/5 steps found)
superpathway of L-lysine degradation (11/43 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSL5 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Psest_3829 Predicted acyl-CoA transferases/carnitine dehydratase (Pseudomonas stutzeri RCH2)
MPGALSHIRVLDLSRVLAGPWCGQILGDLGAEVIKVERPGTGDDTRHWGPPYLKDQHGEN
TSEAAYYLTANRNKQSLTVDFTRPEGQRIIRELVAQCDVLLENFKVGGLAAYGLDYESLK
ALNPRLIYCSITGFGQDGPYATRAGYDFMIQGLGGLMSLTGRSDAEEGAGPVKVGVALTD
ILTGLYATVGVLAALAHRERSGEGQHIDTALLDVQVACLGNQALNYLATGVAPKRMGNAH
PNIVPYQDFPTADGDIILTVGNDGQFRKFCEVAGRPEWATDPRFATNRARVAHRAELIPL
IRQVTVFRTTAEWVSALEQAGVPCGPINDLAQVFADPQVQHRGLNVEMPHPLAGRVPQVA
SPLRLSASPVAYRNPPPLLGEHSEALLQRLLGMNDEQIAGLRAAGVI