Protein Info for Psest_3828 in Pseudomonas stutzeri RCH2

Annotation: zinc-binding alcohol dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details TIGR02817: zinc-binding alcohol dehydrogenase family protein" amino acids 2 to 337 (336 residues), 568.9 bits, see alignment E=2.2e-175 PF08240: ADH_N" amino acids 29 to 91 (63 residues), 53.4 bits, see alignment E=4.2e-18 PF00107: ADH_zinc_N" amino acids 160 to 264 (105 residues), 45.5 bits, see alignment E=1.1e-15 PF13602: ADH_zinc_N_2" amino acids 193 to 334 (142 residues), 61 bits, see alignment E=3.6e-20

Best Hits

KEGG orthology group: None (inferred from 99% identity to psa:PST_0444)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNG8 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Psest_3828 zinc-binding alcohol dehydrogenase family protein (Pseudomonas stutzeri RCH2)
MKAVAYFESLAIDDPRALQDVELPQPVPGPRDLLVEVRAISVNPVDTKVRRNTQPEVGQP
KVLGWDVAGVVVGVGSEVSLFKVGDEVFYAGSIARAGGNSERHLVDERIVGRKPRSLSFA
EAAALPLTAITAWELLFERLQLVEGQGAGQQLLIVGAAGGVGSIMLQLARQLTKVSVIAT
ASRPETQAWARELGAHHVIDHSQPLHAELQRAGFASVSHVASLTQTDQHFDQLVEALTPQ
GRLALIDDPAQPLDVMKLKRKSLSLHWELMFTRSLFETPDMIEQHHLLQRVSQLVDLGVL
RSTLGEHFGTINAANLRRAHALLESGKAKGKIVLEGF