Protein Info for HP15_3698 in Marinobacter adhaerens HP15

Annotation: tRNA modification GTPase TrmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF10396: TrmE_N" amino acids 19 to 132 (114 residues), 136.8 bits, see alignment E=8.2e-44 TIGR00450: tRNA modification GTPase TrmE" amino acids 24 to 468 (445 residues), 347.8 bits, see alignment E=1.1e-107 PF12631: MnmE_helical" amino acids 135 to 465 (331 residues), 205.4 bits, see alignment E=2.4e-64 TIGR00231: small GTP-binding protein domain" amino acids 228 to 385 (158 residues), 77.6 bits, see alignment E=9.4e-26 PF02421: FeoB_N" amino acids 230 to 383 (154 residues), 32.6 bits, see alignment E=1.1e-11 PF01926: MMR_HSR1" amino acids 230 to 348 (119 residues), 83.7 bits, see alignment E=2.1e-27

Best Hits

Swiss-Prot: 89% identical to MNME_MARHV: tRNA modification GTPase MnmE (mnmE) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K03650, tRNA modification GTPase (inferred from 89% identity to maq:Maqu_3894)

MetaCyc: 67% identical to 5-carboxymethylaminomethyluridine-tRNA synthase GTPase subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"GTPase and tRNA-U34 5-formylation enzyme TrmE" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHG1 at UniProt or InterPro

Protein Sequence (468 amino acids)

>HP15_3698 tRNA modification GTPase TrmE (Marinobacter adhaerens HP15)
MEPLLFSACGKSMSQSSDTIAAIATAPGQAGVGIVRISGPKSLAIAKKMLGFEPKPRYAH
YGPFHDSHGELIDEGIGLFFPNPHSFTGEDVFELQGHGGTVILDLLLREVCGQGARLARP
GEFSERAFLNDKLDLAQAEAIADLIESSSEQAARCAVRSMQGVFSRQIEDLVDAVTHLRI
YVEAAIDFPEEEIDFLADGKVASDLQNLLERLGKILAEAQQGTILRDGMKVVIGGRPNAG
KSSLLNALAGREAAIVTAIEGTTRDVLREHIHIDGMPLHIIDTAGLRDSPDEVEQIGIAR
AWEEIRQADRILLMVDATTTEKTSPHEIWPDFIDQLPANAPVTVIRNKVDLSGETVGISA
EDHQSAPVIRLAAKSAEGLEILRDHLKQCMGFASTTEGGFLARRRHLDALERAQALLIQG
QSQLEGFGAGELLAEDLRAAQDSLGEITGHLTPDELLGKIFSSFCIGK