Protein Info for Psest_3822 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF12833: HTH_18" amino acids 259 to 336 (78 residues), 84.2 bits, see alignment E=6.2e-28 PF00165: HTH_AraC" amino acids 296 to 335 (40 residues), 27.4 bits, see alignment 3e-10

Best Hits

KEGG orthology group: None (inferred from 53% identity to azo:azo3816)

Predicted SEED Role

"transcriptional regulator, AraC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR73 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Psest_3822 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain (Pseudomonas stutzeri RCH2)
MARSEIAERPPLTVALLATPDSTASTLFGLYDLLLGARRDWQQLLHRADVASPFLPLIVS
RDGRSLRVYNDIPVHPHTSLDDAPPTDVVIVSNLAVSPWEPLDDRYAPEAQWLCERYAAG
ATLAAACSGAMLLARTGLLAGCEGTSHWGYCDCLRREYPDVHWHPDKALVSTGVGQRLVM
SGSGSSWHALGLFLIARFVGAREAMEVARMNLFDWDATSPLAYAAMMRTGQLADPVIARC
QEWAAQHYEEEAPVSAMVRISGLPERTFQRRFALATGLTPLDYIHTLRLEEAKQLLESGE
LSVEAIAWEVGYQDAGFFGRLFRRKVGLTPAQYRRRFGVLSRRLAGIATLQQAAPAVH