Protein Info for Psest_3814 in Pseudomonas stutzeri RCH2

Annotation: TIGR00255 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00255: TIGR00255 family protein" amino acids 1 to 287 (287 residues), 302 bits, see alignment E=2.8e-94 PF03755: YicC-like_N" amino acids 2 to 153 (152 residues), 145.5 bits, see alignment E=1.8e-46 PF08340: YicC-like_C" amino acids 171 to 287 (117 residues), 135.9 bits, see alignment E=7.3e-44

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_0462)

Predicted SEED Role

"Protein YicC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSK1 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Psest_3814 TIGR00255 family protein (Pseudomonas stutzeri RCH2)
MVHSMTAFARSEQAGTHGTLSWEIRSVNHRYLEPHLRLPEAFRDLEGAVRDALRKGLSRG
KVECTLRFAEENNRTALQVDRERASQLIAAAESVAALISQPAAIDPLQVLSWPGVLVGDA
LDPQALNQSALQLFHDALEQLKEGRRREGEELAKLLNERLDSILEEVATLREQVPQMLAA
QRQKVLDRFAEMRAELEPQRLEQEMVLLAQKSDVAEELDRLSTHVTEVRRVLKTGGAAGR
RLDFLMQELNREANTLGSKAFDPRSTQAAVNLKVLIEQMREQVQNLE