Protein Info for Psest_3812 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details PF09685: MamF_MmsF" amino acids 13 to 121 (109 residues), 120 bits, see alignment E=3.1e-39

Best Hits

KEGG orthology group: K09940, hypothetical protein (inferred from 95% identity to psa:PST_0464)

Predicted SEED Role

"FIG00955116: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR64 at UniProt or InterPro

Protein Sequence (122 amino acids)

>Psest_3812 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MTDQDLVPLPSREARQWAMFCHYSAFFWFLAPMIGNVIGPLIVWQLKKEMDPFVDQQGRE
ALNFQLTFSIAMMICGVLAWILIGFPLMVLVSVVALVLVVIAGIRANEGKPYRYPFCWRI
VK