Protein Info for HP15_3681 in Marinobacter adhaerens HP15

Annotation: ATP synthase F1, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 TIGR00962: ATP synthase F1, alpha subunit" amino acids 4 to 513 (510 residues), 830.4 bits, see alignment E=2.6e-254 PF02874: ATP-synt_ab_N" amino acids 30 to 93 (64 residues), 53.7 bits, see alignment E=3.6e-18 PF00006: ATP-synt_ab" amino acids 150 to 376 (227 residues), 264.4 bits, see alignment E=1.2e-82 PF00306: ATP-synt_ab_C" amino acids 383 to 508 (126 residues), 162.5 bits, see alignment E=8.9e-52

Best Hits

Swiss-Prot: 95% identical to ATPA_MARHV: ATP synthase subunit alpha (atpA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 95% identity to maq:Maqu_3877)

MetaCyc: 74% identical to ATP synthase F1 complex subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PHE4 at UniProt or InterPro

Protein Sequence (514 amino acids)

>HP15_3681 ATP synthase F1, alpha subunit (Marinobacter adhaerens HP15)
MQQLNPSEISDIIKKRIEKLDISSEAKNEGTILSVSDGIVLIHGLADVMYGEMIEFANGT
FGMALNLERDSVGAVVLGDYEDLAEGQKVRCTGRILEVPVGPELMGRVVDALGNPIDGKG
DLGTDLTSPVEKVAPGVIARQSVDEPVQTGLKAIDTMVPIGRGQRELIIGDRQIGKTAVA
IDAIINQKDTGIKCIYVAVGQKQSSIAAVVRKLEEHGAMDHTIVVAAGAADPAAMQFLAP
YSGTSMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRPPGREAYPGDVFYLHSRLLE
RASRVNADYVEQLTNGEVKGQTGSLTALPIIETQAGDVSAFVPTNVISITDGQIFLETNL
FNSGIRPAMNAGISVSRVGGSAQTKIMKKLGGNIRLALAQYRELAAFAQFASDLDEATRQ
QLEHGQRVTELMKQNQYSPMSVAEMGTVLFAANEGFLDDVDVDKVVKFEAQMLDWMRSEQ
KDLLDKINEKGDYNDEIAAGLKAALEKFKTTQSW