Protein Info for PGA1_262p01370 in Phaeobacter inhibens DSM 17395

Annotation: putative dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF00355: Rieske" amino acids 43 to 124 (82 residues), 61.6 bits, see alignment E=5.7e-21 PF00848: Ring_hydroxyl_A" amino acids 189 to 379 (191 residues), 119.5 bits, see alignment E=2e-38

Best Hits

KEGG orthology group: None (inferred from 75% identity to sit:TM1040_2059)

Predicted SEED Role

"GbcA Glycine betaine demethylase subunit A" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESU1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>PGA1_262p01370 putative dioxygenase (Phaeobacter inhibens DSM 17395)
MNTHSPLSSVLAPVNTANGLPNEHYVDPRVFDEEKKSVLFANWSGIGFGKDIPEPGDAKP
VDFLGMPLLLVRDRTGEIGVFQNTCRHRGMILVDKPQKIRGAIRCPYHSWCYGLNGALRT
TPHVGGPGQNTHEDVDMDKLGLIRIRSHIWRDVIFVNVDGQAPDFATAHAGLLERWQEFE
TPIHHGGEGSSLKLEVATNWKLAVENYCESYHLPWVHPGLNSYSRLEDHYNIEERGQYSG
QGTLVYRQLTDEGGSKLPDFAGLSGQWDEGAEYIAVYPNVLLGVQRDHSFAIVLEPKACG
HTVEHIELYYAQSERDTPELDGLRASNAQLWKTVFEEDVFVVEGMQKGRHGILFDGGRFS
PAMDGPTHNFHHWVATQVQKGRAA