Protein Info for Psest_3795 in Pseudomonas stutzeri RCH2

Annotation: Glycine/D-amino acid oxidases (deaminating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF01494: FAD_binding_3" amino acids 45 to 77 (33 residues), 24.7 bits, see alignment (E = 2.6e-09) PF00890: FAD_binding_2" amino acids 46 to 75 (30 residues), 23 bits, see alignment (E = 8.7e-09) PF01266: DAO" amino acids 46 to 399 (354 residues), 246.4 bits, see alignment E=1.3e-76 PF13450: NAD_binding_8" amino acids 49 to 88 (40 residues), 26.9 bits, see alignment 9.6e-10

Best Hits

KEGG orthology group: None (inferred from 95% identity to psa:PST_0481)

Predicted SEED Role

"Gamma-glutamyl-putrescine oxidase (EC1.4.3.-)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSA8 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Psest_3795 Glycine/D-amino acid oxidases (deaminating) (Pseudomonas stutzeri RCH2)
MQTFHDTSVNHRASASNTSDHAPSYYAASVNRELSFEPLQGEQRADVCIVGGGFSGLNTA
IELAERGLSVILLEAHRIGWGASGRNGGQLIRGVGHDVEQFTNILGEEGVDELKRMGFEA
VDIVRQRIERYAIDCDLTWGYCDLATKPRHLKGFDEEYSDLLRLGYPHPLQRVSRPNLAT
VVGSQRYLGGLLDMGSGHLHPLNLALGEAAAAQSLGVRLFEQSAVERIEYGPQVALHTAQ
GVVHADNLVLACNAYLNGLQPKLAGKVLPAGSYIIATERLPEPLQRELLPQNMAVCDQRV
ALDYFRLSADGRLLFGGACHYSGRDPKDIAAYMQPKMLEVFPQLIGIGIDYQWGGMIGIG
ANRLPQIGRLPEQPNVFYAQAYSGHGLNATHLAGHLLAEAIATQESHGFDLFAQVPHPTF
PGGRALRSPLLALGMLWYRLKDRF