Protein Info for Psest_3793 in Pseudomonas stutzeri RCH2

Updated annotation (from data): D-alanine dehydrogenase (EC 1.4.99.-)
Rationale: Specifically important for utilizing D-Alanine. Automated validation from mutant phenotype: the predicted function (DALADEHYDROG-RXN) was linked to the condition via a SEED subsystem. A more specific reaction was selected manually.
Original annotation: Glycine/D-amino acid oxidases (deaminating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF01266: DAO" amino acids 2 to 398 (397 residues), 270.3 bits, see alignment E=7e-84 PF00890: FAD_binding_2" amino acids 3 to 257 (255 residues), 22.8 bits, see alignment E=1e-08 PF13450: NAD_binding_8" amino acids 5 to 39 (35 residues), 24.7 bits, see alignment 4.8e-09

Best Hits

Swiss-Prot: 96% identical to DADA_PSEU5: D-amino acid dehydrogenase (dadA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 96% identity to psa:PST_0483)

MetaCyc: 62% identical to D-amino acid dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN-11193 [EC: 1.4.5.1]; 1.4.5.- [EC: 1.4.5.1]

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.5.1 or 1.4.99.- or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GND6 at UniProt or InterPro

Protein Sequence (432 amino acids)

>Psest_3793 D-alanine dehydrogenase (EC 1.4.99.-) (Pseudomonas stutzeri RCH2)
MRVLVLGSGVVGTASAYYLARAGFEVVVVDRQPAVAMETSFANAGQVSPGYASPWAAPGV
PLKAMKWLLQRHAPLAIKLTGDVDQYLWMAQMLRNCTAARYAVNKERMVRLSEYSRDCLD
ELRAETGIAYEGRQLGTTQLFRTQAQLDAAAKDIAVLERSGVPYELLDRAAIGRVEPALA
KVAHKLSGALRLPNDQTGDCQMFTSRLAEMALALGVEFRFGQNIQRLEHAGDRIAGVWID
GKLETADRYVLALGSYSPQMLKPLGIRAPVYPLKGYSLTVPISDPAMAPQSTVLDETYKV
AITRFDQRIRVGGMAEIAGHDLSLNPRRRETLEMVVGDLYPQGGDPAEAVFWTGLRPATP
DGTPIIGATAYRNLYLNTGHGTLGWTMACGSGRVLADLLASKRPQISTDGLDIFRYGKHK
ETRKHAHPAAAH