Protein Info for PGA1_262p01170 in Phaeobacter inhibens DSM 17395

Annotation: putative nnrS protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 227 to 243 (17 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 373 to 373 (1 residues), see Phobius details amino acids 375 to 398 (24 residues), see Phobius details PF05940: NnrS" amino acids 21 to 401 (381 residues), 342.9 bits, see alignment E=1.5e-106

Best Hits

KEGG orthology group: K07234, uncharacterized protein involved in response to NO (inferred from 54% identity to dsh:Dshi_2303)

Predicted SEED Role

"NnrS protein involved in response to NO" in subsystem Denitrification or Nitrosative stress or Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESS3 at UniProt or InterPro

Protein Sequence (407 amino acids)

>PGA1_262p01170 putative nnrS protein (Phaeobacter inhibens DSM 17395)
MTVTTDAGRKETNASSWAPAILSYGFRPFFFLAALWAGLAMIAWIGQLSGVLTLPIMLDP
VSWHAKAFLFGYLSAVLAGFLLTAAPNWTGGAPLNGWPLLGLVLLWLAGRVTDLYTADLP
AVVVACVDVSFPLILGAVILREVIAGRNWRNLVVLVLLGLHTLALLLVHLETAGGGYPAQ
GLGMRLGLATVIGMICLIGGRIIPSFTGNWLLKMGVDARPASPMQRLDKFVFAISLPALG
IWVAAPDHIAAAVALTIFAMGHLLRLARWQGHRTAAEPLLAVLHLAYAMVPCGAVIMAIS
KIPHVPLDTAAAQHLWMAGAIGMMTLAVMIRATLGHTGRRLVAGPGAKLILLAVLVASVI
RIVAGIGVGSAGWLYHLSAAAWCTAFFGYALVYGAALFSARRAAVQA