Protein Info for Psest_3775 in Pseudomonas stutzeri RCH2

Annotation: Mg chelatase-related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 TIGR00368: Mg chelatase-like protein" amino acids 6 to 493 (488 residues), 642.9 bits, see alignment E=1.6e-197 PF13541: ChlI" amino acids 21 to 142 (122 residues), 149.5 bits, see alignment E=1.2e-47 PF01078: Mg_chelatase" amino acids 190 to 390 (201 residues), 320.6 bits, see alignment E=1.1e-99 PF07728: AAA_5" amino acids 213 to 348 (136 residues), 34.6 bits, see alignment E=5.6e-12 PF00493: MCM" amino acids 287 to 387 (101 residues), 28.9 bits, see alignment E=1.8e-10 PF13335: Mg_chelatase_C" amino acids 402 to 493 (92 residues), 99.6 bits, see alignment E=3.9e-32

Best Hits

KEGG orthology group: K07391, magnesium chelatase family protein (inferred from 96% identity to psa:PST_0500)

Predicted SEED Role

"MG(2+) CHELATASE FAMILY PROTEIN / ComM-related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS87 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Psest_3775 Mg chelatase-related protein (Pseudomonas stutzeri RCH2)
MSLAIVHSRAQIGVEAPSVTVEAHLANGLPALTLVGLPETAVKESKDRVRSAILTSGFDF
PPRRITLNLAPADLPKDGGRFDLSIALGILAASGQLPAERLTSLECLGELALSGALRPVQ
GVLPAALAARAAGRALLVPRANAEEASLASGLIVYAAEHLLEVAAHFNGVTPLEPYVAQG
LLRQVQPYPDLADVQGQQAAKRGLLIAAAGAHNLLFSGPPGTGKTLLASRLPGLLPPLDE
QEALEVAAIHSVASHSPLEHWPQRPFRQPHHSASGPALVGGGSRPQPGEITLAHQGVLFL
DELPEFDRKVLEVLREPLESGHIVIARARDKVRFPARFQLVAAMNPCPCGYLGDPNGRCR
CTPDQIQRYRNKLSGPLLDRIDLHLTVAREATALNAPPQTGQSSAVLAAQVAQARQLQLA
RQGCANAFLDLAGLRSHCQLTAEDQAWLERACERLALSLRAAHRLLKVARTLADLEQAAS
ISRQHLAEALQYRPGSQA