Protein Info for PGA1_262p01050 in Phaeobacter inhibens DSM 17395

Annotation: Hemolysin-type calcium-binding repeat (2 copies).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF00353: HemolysinCabind" amino acids 125 to 157 (33 residues), 30.6 bits, see alignment 1.3e-11 amino acids 159 to 193 (35 residues), 36.6 bits, see alignment 1.7e-13 amino acids 185 to 220 (36 residues), 30.1 bits, see alignment 1.9e-11 amino acids 195 to 228 (34 residues), 40 bits, see alignment 1.6e-14 amino acids 213 to 244 (32 residues), 27.6 bits, see alignment 1.2e-10

Best Hits

KEGG orthology group: None (inferred from 46% identity to sit:TM1040_1599)

Predicted SEED Role

"FIG00918833: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2B9 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PGA1_262p01050 Hemolysin-type calcium-binding repeat (2 copies). (Phaeobacter inhibens DSM 17395)
MANVFVASFPGVSSLSNYLAFDGFETSRTSFGTVVSPTELEQISEDGSILRLGGDFSSDD
QADWQIFSMDHSLDGSPIVSISDISMSFDRFVSLRAEDVARELLSGDDQITALLNDNVTA
IRTYAGGDRISLGAGDDTVAAGAGNDFLTGGLGADVLRGGSGADTLHGNGGDDVLRGGVG
RDVIFGGVGADLLGGGRGNDRLIGGSGSDTIRGGAGVDRLYGGTGDDVMTGGDGADIFVF
NEGDHTDRITDFEVGVDRIKLGRGAESMDDVDFAQVGDDAAIYFANVTILVEDTAFSELQ
SADHFLF