Protein Info for HP15_363 in Marinobacter adhaerens HP15

Annotation: biotin-protein ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 139 to 157 (19 residues), see Phobius details PF08279: HTH_11" amino acids 5 to 55 (51 residues), 47.3 bits, see alignment 3.2e-16 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 82 to 318 (237 residues), 164 bits, see alignment E=2.2e-52 PF03099: BPL_LplA_LipB" amino acids 108 to 211 (104 residues), 57.2 bits, see alignment E=3.6e-19 PF02237: BPL_C" amino acids 282 to 318 (37 residues), 23.8 bits, see alignment 6.6e-09

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 61% identity to maq:Maqu_0702)

Predicted SEED Role

"Biotin--protein ligase (EC 6.3.4.9, EC 6.3.4.10, EC 6.3.4.11, EC 6.3.4.15) / Biotin operon repressor" in subsystem Biotin biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLX1 at UniProt or InterPro

Protein Sequence (321 amino acids)

>HP15_363 biotin-protein ligase (Marinobacter adhaerens HP15)
MKSKALIELLSDGQVHSGAALAEKLGVSRTAIWKQIRRAMEEGADIATIRGRGYQLVSRV
DLLDRARVLREIAAGREQELSLTVLDEVDSTNAEVIRQITAGSKGVPVVIADCQTSGRGR
RGRVWQSPRGENLYLSMGLTFHGGFGVLDGLSLVLGVAVANALERLGVPEVGLKWPNDIF
LPDGKLGGILVELQGELEEGVVQVIAGIGLNVHMSRADGVDQPWSSLARACPQVEWSRSQ
IGGAIIDAVFDAVALFSDIGFADFRESWQRRDVFMGKSLKARGGDVEGVGCGIDDAGNYQ
IRTENGLVPVRAGEISLRVAK