Protein Info for Psest_3761 in Pseudomonas stutzeri RCH2

Annotation: Transcription elongation factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF14760: Rnk_N" amino acids 5 to 44 (40 residues), 53.8 bits, see alignment E=2.2e-18 PF01272: GreA_GreB" amino acids 50 to 125 (76 residues), 65.3 bits, see alignment E=3.9e-22

Best Hits

KEGG orthology group: K06140, regulator of nucleoside diphosphate kinase (inferred from 94% identity to psa:PST_0514)

Predicted SEED Role

"Regulator of nucleoside diphosphate kinase" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQD6 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Psest_3761 Transcription elongation factor (Pseudomonas stutzeri RCH2)
MTSAPPIILTQLDLQRLERLLDSLDDYGPAAEALEQELSRAQIVERSEMPAGVVTMNSRV
HCLDEGTGKEYHLTLVYPHDAGKEGTVSVLAPVGTALLGMSVGQHIDWPTPAGKIIKLTL
LAIEYQPEAAGDPF