Protein Info for Psest_0370 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 transmembrane" amino acids 13 to 47 (35 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 420 to 447 (28 residues), see Phobius details amino acids 467 to 490 (24 residues), see Phobius details PF01970: TctA" amino acids 18 to 442 (425 residues), 483.9 bits, see alignment E=1.8e-149

Best Hits

Swiss-Prot: 35% identical to YZ2R_AGRVI: Uncharacterized 52.8 kDa protein in TAR-I ttuC' 3'region from Agrobacterium vitis

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 90% identity to pmy:Pmen_1211)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG74 at UniProt or InterPro

Protein Sequence (506 amino acids)

>Psest_0370 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MLELLQQGFGAVFSLNILLLMLGGVAVGIVFGAVPGLSATMAVALCLPLTFTMGPQAGLS
LLVALFIGATSGGLISAILLKIPGTPSSIATVFDGGPLMEQGMGVKALGVGIVFSFLGTI
FSIIALMFIAPQLAKVALSFGPHEYFAIAVFSLTLIATLSAGSMVKGLFAGTLGIAVSTV
GIAPVEAVRRFTFGVSELNGGFSMLTVMIGMFAVAEVIKLAETGRHAVRNKAGSVSMKQI
KGFGFSLKEFRQELPNATRSGLIGLAVGILPGIGAGTSNLLSYIVAKKRAKQPETYGKGN
IGGVVASETANNAGIGGAMMPLMTLGIPGDTTTAILLGGFLIHGIQPGPLLFISQGPLVY
TIFAALLVASVMMLFMEFYGLRLFIKLLDVPKHILLPIILVLCVVGAFGLSSRLFDVWSI
LLFGVLGYGFVKAGMPVAPFIIGFILGPMAETNLRRGLMLSDGNFASFFTNPIAATFLGL
ALAFVLWQLYSAMRPRSGVLGQALRT