Protein Info for PGA1_262p00890 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, integral inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 71 to 102 (32 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 57% identity to pde:Pden_1610)

Predicted SEED Role

"FIG00918922: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWE8 at UniProt or InterPro

Protein Sequence (269 amino acids)

>PGA1_262p00890 ABC transporter, integral inner membrane component (Phaeobacter inhibens DSM 17395)
MQLASRRNLLFAAIILLCLAIWLAGAGGWLEYHSSRAVLAPPGLGHWLGTNEIGQEVLIG
LILATPTTLTLAMATAVVTVSLAVGAASLVVFGGPFLSALMLRCVDVLQVVPTMLLLLLV
AALVSPGFTALFLLLVLTGWSDDVRVAAAVLRREALRENVQYARVMGAGWFYCWRWHLFA
ALRPLLGALMVQNIRQAALKSAGLGFLGLTDPRLLTWGSMMQSAMDQLYTGAWMWLLLPP
AALLSLLLHTTLKLGDRRLRSGAVLGPVF