Protein Info for Psest_0369 in Pseudomonas stutzeri RCH2

Annotation: L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF02746: MR_MLE_N" amino acids 43 to 138 (96 residues), 49.3 bits, see alignment E=5.6e-17 PF13378: MR_MLE_C" amino acids 161 to 365 (205 residues), 208.6 bits, see alignment E=9.9e-66

Best Hits

Swiss-Prot: 58% identical to TAGAD_SALTY: L-talarate/galactarate dehydratase (STM3697) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 64% identity to mno:Mnod_4686)

Predicted SEED Role

"mandelate racemase/muconate lactonizing enzyme family protein" in subsystem Catechol branch of beta-ketoadipate pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHX0 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psest_0369 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily (Pseudomonas stutzeri RCH2)
MSDLYEADRISWIGLRAVELPLQRPVSDAKVLTGRQLPLASVSLLFVELQSQQGHKGLGF
SYSLRSGGPAQYAHARELAPLLLGEDPNDIARLWSRLSWASASIGRGGLAVQSIAAFDTA
LWDLKARRAGLPLAKLLGAHRDAVPCYNTSGGYLQAPIEEVIEKAEASRARGIGGIKLKV
GQPDRHADLRRVEALRKHFGDGVALMVDVNQQWDRTTAARMGRALEEFELTWIEEPLDAH
DLEGHAALAAQLITPVGTGEMLGSAAEACAFIERGAVDVIMHDAPRIGGITPFLQVAEAA
RRRGIVMAPHFVMELHIHLAAAYEHATWVEHFEWLEPLFRERLEIRDGCMQVPTRAGLGL
SLSEQVAGWTLASETFGTKP