Protein Info for PGA1_262p00810 in Phaeobacter inhibens DSM 17395

Annotation: putative flavoprotein, HFCD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 108 to 130 (23 residues), see Phobius details PF02441: Flavoprotein" amino acids 9 to 179 (171 residues), 65.9 bits, see alignment E=1.7e-22

Best Hits

KEGG orthology group: None (inferred from 60% identity to xbo:XBJ1_1746)

MetaCyc: 54% identical to Lantibiotic biosynthesis protein (Streptomyces clavuligerus)
4.1.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ESP4 at UniProt or InterPro

Protein Sequence (189 amino acids)

>PGA1_262p00810 putative flavoprotein, HFCD family (Phaeobacter inhibens DSM 17395)
MTDTASRPRILIGVTGSLDATMLPLYLRAIKNEIDCELTALFTPTATKFVNMDAVALFLD
RVISGDNPKDWPTDKPGRIVADHDILAILPTTANTLSAIAHGSSQNRLTTVILAATFPVL
LFPVMGGPMWEKPAVRRNVSQLREDGYEVFEPVWRENYDPLLKIQHGHHSLPDPEKVVQI
LQNRLPTAR