Protein Info for Psest_3744 in Pseudomonas stutzeri RCH2

Annotation: Disulfide bond formation protein DsbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 25 (14 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details PF02600: DsbB" amino acids 7 to 157 (151 residues), 152.5 bits, see alignment E=5.7e-49

Best Hits

Swiss-Prot: 94% identical to DSBB_PSEU5: Disulfide bond formation protein B (dsbB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 94% identity to psa:PST_0528)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GS56 at UniProt or InterPro

Protein Sequence (163 amino acids)

>Psest_3744 Disulfide bond formation protein DsbB (Pseudomonas stutzeri RCH2)
MRLASPRSLFVIAFLGSALLIAIALYMEHVMGLAPCPLCIVQRVCVIGFGLVCLIAAIHG
PAKTGRRIYSGFALLFVLAGAATAIRQIWLQSVPADQLPSCLPSLEYMMEALPFQEIARL
VLHGTAECAEVSWTMLGMSIPEWSLLGFIGMAILCLWQLLRRD