Protein Info for Psest_3740 in Pseudomonas stutzeri RCH2

Annotation: ATPase components of ABC transporters with duplicated ATPase domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 PF00005: ABC_tran" amino acids 17 to 178 (162 residues), 82.6 bits, see alignment E=1e-26 amino acids 328 to 459 (132 residues), 80.7 bits, see alignment E=4.1e-26 PF12848: ABC_tran_Xtn" amino acids 217 to 296 (80 residues), 98.9 bits, see alignment E=3.7e-32

Best Hits

Swiss-Prot: 59% identical to YHES_ECO57: Uncharacterized ABC transporter ATP-binding protein YheS (yheS) from Escherichia coli O157:H7

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 94% identity to psa:PST_0532)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQC1 at UniProt or InterPro

Protein Sequence (636 amino acids)

>Psest_3740 ATPase components of ABC transporters with duplicated ATPase domains (Pseudomonas stutzeri RCH2)
MIRLQNLTLQRGPQRLLEGAELTLHPGQKAGLIGANGAGKSTLFALLRGEMVPDGGDCQL
PPDWRIAHMRQEIDTLDRLAVDYVLDGDVELRRVQRELAAAEQAHDGNALARLHTELDNL
DGYSADARARKLLAGLGFANEQMTLPVSSFSGGWRMRLNLAQALMCPSDLLLLDEPTNHL
DLDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVIHLEQRKLTLYRGGYSAFERTRAE
RLAQQQQAFEKQQAQRAHMESYIRRFKAQATKARQAQSRIKALERLEELAPAHVDSPFDF
RFREADKVSSPLLDLAEARLGYGEKVVLEKVKLQLVPGARIGLLGPNGAGKSTLIKTLAA
ELTPLSGRLQRGENLAVGYFAQHQLDSLDPKASPLLHLQRIAPSEREQTLRDFLGGFDFR
GVRCDEPVLNFSGGEKARLALALIAWGKPNLLLLDEPTNHLDLEMRLALTMALQDFEGAV
LVVSHDRHLLKSTTDEFLLVADGQVQSFDGDLEDYARWLVDYRARQQPVASGEPAADKTD
KRAQRQAAAALRQQLAPHKRQADKLEKDLATVHEKLAELETSLGDSALYEVARKDELRQL
LAKQAELKVREGELEEAWLEALETLEALQAQLEASA