Protein Info for Psest_3737 in Pseudomonas stutzeri RCH2

Annotation: Putative threonine efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 210 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 40 to 65 (26 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details PF01810: LysE" amino acids 16 to 204 (189 residues), 109.7 bits, see alignment E=6.8e-36

Best Hits

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 96% identity to psa:PST_0535)

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSC9 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Psest_3737 Putative threonine efflux protein (Pseudomonas stutzeri RCH2)
MSLETWLAFFVACWVISLSPGAGAIASMSCGLQYGFWRGYWNAIGLQLALVLQIAVVAAG
VGAVLATSELAFGLIKWFGVGYLLWLAWKQWQAQPQALDDSAAPRPIGRPLSLVLRGFVV
NASNPKAIVFILAVLPQFLDPQRPLLLQYSEMAATMVVVDLIVMAAYTGLAAKVLRLLRT
PRQQRLINRSFAAAFAGAAALLATVRRAVV