Protein Info for PGA1_262p00690 in Phaeobacter inhibens DSM 17395

Annotation: stressosome protein rsbRA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF14361: RsbRD_N" amino acids 19 to 161 (143 residues), 43 bits, see alignment E=9.9e-15 PF01740: STAS" amino acids 171 to 269 (99 residues), 57.4 bits, see alignment E=1.6e-19 PF13466: STAS_2" amino acids 175 to 260 (86 residues), 32.4 bits, see alignment E=1.3e-11

Best Hits

KEGG orthology group: None (inferred from 43% identity to aba:Acid345_2416)

Predicted SEED Role

"RsbR, positive regulator of sigma-B" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWD0 at UniProt or InterPro

Protein Sequence (291 amino acids)

>PGA1_262p00690 stressosome protein rsbRA-like protein (Phaeobacter inhibens DSM 17395)
MSETATETVLTILQNDFEEIVASWISTQSDEGVQRIDLFSHKEGREQTSGLLRALISGIE
KGATGDRFDLSSDAWVDLRSVLVDVTKERSSRGVSPSDMASFVLALKAPVFYRLKDKLAK
YPTNLVEEIWFFSRVIDAFAVYCAEVFIAERDRIIEQQRDQMQELSTPVVELWDKVLTLP
LIGTMDSARAQEVMENLLETILRRQAEVVIVDLTGVQTVDTQVAQHMLRMAAAVRLMGAQ
CIISGISPTIAQTMVQLGVDVGEVTTRSTIRSGLADALNRVGYEITKKKDH