Protein Info for Psest_3728 in Pseudomonas stutzeri RCH2

Annotation: UbiD family decarboxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00148: decarboxylase, UbiD family
  • amino acids 6 to 455 (450 residues), 570.4 bits, E=1.2e-175
• PF20695: UbiD_N
  • amino acids 11 to 89 (79 residues), 98.9 bits, E=2.1e-32
• PF01977: UbiD
  • amino acids 123 to 322 (200 residues), 276.2 bits, E=1.8e-86
• PF20696: UbiD_C
  • amino acids 328 to 452 (125 residues), 158.6 bits, E=1.2e-50

Best Hits

Swiss-Prot: 98% identical to UBID_PSEU5: 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03182, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiD [EC: 4.1.1.-] (inferred from 98% identity to psa:PST_0544)

MetaCyc: 77% identical to 3-octaprenyl-4-hydroxybenzoate decarboxylase (Escherichia coli K-12 substr. MG1655)
3-OCTAPRENYL-4-OHBENZOATE-DECARBOX-RXN [EC: 4.1.1.98]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of chorismate metabolism (44/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• plastoquinol-9 biosynthesis II (1/5 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (3/8 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.98

Sequence Analysis Tools

See L0GS42 at UniProt or InterPro

Protein Sequence (488 amino acids)

>Psest_3728 UbiD family decarboxylases (Pseudomonas stutzeri RCH2)
MQYRDLRDFISGLEKRGELKRITTAVSPVLEMTEICDRTLRKQGPALLFENPTGFDMPVL
GNLFGTPQRVALGMGAEDVSELREIGKLLAFLKEPEPPKGLKDAWSKLPIYKKVISMAPK
VLKDAPCHEVIIEGDDVDLGKIPVQHCWPGDAAPLITWGLTITKGPNKERQNLGIYRQQV
IGRNKVIMRWLSHRGGALDFREWCEKYPERPYPVAVALGADPATILGAVTPVPDTLSEYA
FAGLLRGSRTELVKAIGSDLQVPAYAEIVLEGHIYPGEMADEGPYGDHTGYYNEVDRFPV
FTVERITQRKNPIYHSTYTGRPPDEPAILGVALNEVFVPILQKQFPEIVDFYLPPEGCSY
RMAVVTMKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTDDDINARDWNDVIWAITTRMDP
KRDTVMIDNTPIDYLDFASPISGLGSKMGLDATHKWPGETNREWGRAIVQDPAVKQRVDE
LWSQLGID