Protein Info for Psest_0367 in Pseudomonas stutzeri RCH2

Annotation: Predicted branched-chain amino acid permease (azaleucine resistance)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details amino acids 217 to 232 (16 residues), see Phobius details PF03591: AzlC" amino acids 25 to 164 (140 residues), 122 bits, see alignment E=1.3e-39

Best Hits

KEGG orthology group: None (inferred from 71% identity to vpa:VPA1003)

Predicted SEED Role

"putataive branched-chain amino acid transport protein AzlC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GE33 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Psest_0367 Predicted branched-chain amino acid permease (azaleucine resistance) (Pseudomonas stutzeri RCH2)
MHDAEIDLHHFDRRMVWAGFRQLAPISIFVTLFGAAFGLAAVQTGLDDTVILAMSALVFA
GASQFAALELWGTQVPLFTLMLTVFAINARHLLMGATLYPWLRQLPTRRRYGVMLIASDA
NWAMAMQAFNRNRPGFGLLFGGGLALWSFWVVGSWLGIHFGSAVSDPKRLGLDMVMGCFL
LAMVVGGEKNLRMLAIWGIAAGASLLAFRYLPENSHVVVGALAGGLAGVLWKEKMRES