Protein Info for Psest_3713 in Pseudomonas stutzeri RCH2

Annotation: 3-dehydroquinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01357: 3-dehydroquinate synthase
  • amino acids 13 to 350 (338 residues), 385.2 bits, E=1.4e-119
• PF13685: Fe-ADH_2
  • amino acids 25 to 184 (160 residues), 57.9 bits, E=2.1e-19
• PF00465: Fe-ADH
  • amino acids 34 to 267 (234 residues), 35.9 bits, E=6.2e-13
• PF01761: DHQ_synthase
  • amino acids 65 to 323 (259 residues), 358.9 bits, E=2.1e-111

Best Hits

Swiss-Prot: 90% identical to AROB_PSEU5: 3-dehydroquinate synthase (aroB) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01735, 3-dehydroquinate synthase [EC: 4.2.3.4] (inferred from 90% identity to psa:PST_0559)

MetaCyc: 60% identical to 3-dehydroquinate synthase (Escherichia coli K-12 substr. MG1655)
3-dehydroquinate synthase. [EC: 4.2.3.4]

Predicted SEED Role

"3-dehydroquinate synthase (EC 4.2.3.4)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Type IV pilus (EC 4.2.3.4)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• 3-dehydroquinate biosynthesis I (2/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.4

Sequence Analysis Tools

See L0GS26 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Psest_3713 3-dehydroquinate synthase (Pseudomonas stutzeri RCH2)
MHTLQVDLGERSYPIHIGERLLDRPELFSDKIRGRQVAIVTNETVAPLYLDRLTRTLSNH
AVTPVILPDGEEHKNWQTLQLIFDALLGARHDRNTTIIALGGGVVGDMAGYAAASYQRGV
DFIQVPTTLLSQVDSSVGGKTGINHPLGKNMIGAFYQPRAVVIDTTTLATLPARELSAGL
AEVIKYGLICDEPFLGWLETNIDLIRALDSAALTEAIQRSCAAKAKVVNADERESGVRAI
LNLGHTFGHAIETHMGYGVWLHGEAVAAGTVMALEMSCQLGWIGEAERDRAIRLLQRAAL
PVVPPAQMRPQDFLEHMAVDKKVLDGRLRLVLLRQLGEAVVTGDFPRDVLETTLNANYGA
MTEPLGA