Protein Info for HP15_3582 in Marinobacter adhaerens HP15

Annotation: transport system permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 174 to 183 (10 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 230 to 258 (29 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 300 to 319 (20 residues), see Phobius details PF01032: FecCD" amino acids 13 to 320 (308 residues), 303.9 bits, see alignment E=1.1e-94 PF00950: ABC-3" amino acids 57 to 286 (230 residues), 20.3 bits, see alignment E=3.7e-08

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 62% identity to mpo:Mpop_4300)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGN7 at UniProt or InterPro

Protein Sequence (326 amino acids)

>HP15_3582 transport system permease protein (Marinobacter adhaerens HP15)
MISLGAGLTLGLTLLAFGAVMIGPYNLTPGQTLAALLGQGDTQAQIVVWNIRLPRVAAAL
LVGAALAAAGASYQALFRNPLVSPDILGVSAGAGLGAVAGIFLSLPVAAIQASAFVGGML
AVGFVILVASLVRNTDRTLTLVLIGVVIGALAGAATSLLKVMADPYDQLPAITFWLLGSL
AATTTEDILPTLPMVLIGLVPLALLRWRINVLSLGDEEARALGIDVSKTRFLVIVAATLI
TASVTALAGVVGWVGLVIPHIARMLVGPGFGRLLPTSVLIGAGYLLVVDTLARTMAQVEV
PLGILTAVIGAPFFVWLLARGRRGWS