Protein Info for Psest_0365 in Pseudomonas stutzeri RCH2

Annotation: NAD dependent epimerase/dehydratase family.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 11 to 156 (146 residues), 30.5 bits, E=5.1e-11
• PF01370: Epimerase
  • amino acids 13 to 174 (162 residues), 80.2 bits, E=4.2e-26
• PF01073: 3Beta_HSD
  • amino acids 14 to 133 (120 residues), 46.6 bits, E=5.9e-16
• PF16363: GDP_Man_Dehyd
  • amino acids 52 to 170 (119 residues), 53.2 bits, E=8.5e-18
• PF07993: NAD_binding_4
  • amino acids 62 to 177 (116 residues), 28.1 bits, E=2.9e-10

Best Hits

Swiss-Prot: 76% identical to URODH_PSESM: Uronate dehydrogenase (udh) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 79% identity to pmy:Pmen_3299)

MetaCyc: 76% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• D-glucuronate degradation III (2/2 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• D-glucuronate degradation II (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• D-galacturonate degradation III (1/2 steps found)
• D-galacturonate degradation II (3/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (1/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (1/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (11/31 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

See L0GG71 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psest_0365 NAD dependent epimerase/dehydratase family. (Pseudomonas stutzeri RCH2)
MTTTPTPQFGRLLLTGAAGGLGKELRERLQPYARIIRLSDIAPMAPAAGAHEEVMPCDLA
DKAAVHALCEGVDAIAHFGGVSVERSFEEILDANIRGTFHIYEAARLHGIKRVVFASSNH
VIGFYPQTETLDAHSPRRPDGYYGLSKSYGEDMANFYYDRYGIETVSIRIGSSFPEPANR
RMMSTWLSFRDLTELMRCALFTPAVGHTVVYGMSANRDVWWDNHLAAHLGFSAQDSSEVF
RDKVEQQPPYSADDPAGIYQGGAFVAAGPFD