Protein Info for Psest_3701 in Pseudomonas stutzeri RCH2

Annotation: 3-oxoacyl-(acyl-carrier-protein) synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 320 to 334 (15 residues), see Phobius details PF00109: ketoacyl-synt" amino acids 52 to 229 (178 residues), 71.8 bits, see alignment E=6.9e-24 PF02801: Ketoacyl-synt_C" amino acids 239 to 337 (99 residues), 91 bits, see alignment E=5.7e-30

Best Hits

KEGG orthology group: K00647, 3-oxoacyl-[acyl-carrier-protein] synthase I [EC: 2.3.1.41] (inferred from 70% identity to pfl:PFL_0464)

Predicted SEED Role

"3-oxoacyl-[ACP] synthase (EC 2.3.1.41) FabV like" (EC 2.3.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.41

Use Curated BLAST to search for 2.3.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN58 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Psest_3701 3-oxoacyl-(acyl-carrier-protein) synthase (Pseudomonas stutzeri RCH2)
MTAYLDALGVICALGSGKAEVAGRLFAGDTSGMQPHPQPVAGRRLPVGAVRCALPALPGD
DPRHATRNNQLLLAAAQEIERDIRTAIARYGQSRIGVVLGTSTTGIQEAAQGIAGLLQNG
AFPPGYHYGHQELAAPASFLGEWLQLAGPCYAISTACTSSARALLSAKRLLDAGICDAVL
CGGVDSLSDLTLQGFTALEATSESLCNPFSRNRNGINIGEAAALFLMTREPGEGAIALLG
GGASSDAYHISAPEPQGRGALAAMRQALATAGCTPEEIDYLNLHGTATAHNDAMESLAVA
TLFPQGVACSSSKPLTGHTLGAAGALEAAFCWLALSRFNADRQLPPHRWDGQPDPDLPPL
RLVTAELRMDRAAPRRLMSNSFAFGGNNISLILGDAP