Protein Info for PGA1_262p00370 in Phaeobacter inhibens DSM 17395

Annotation: putative polysaccharide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 transmembrane" amino acids 21 to 50 (30 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 297 to 322 (26 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 392 to 408 (17 residues), see Phobius details amino acids 421 to 445 (25 residues), see Phobius details amino acids 458 to 478 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 25 to 271 (247 residues), 82 bits, see alignment E=5e-27 PF13440: Polysacc_synt_3" amino acids 50 to 335 (286 residues), 175.4 bits, see alignment E=1.6e-55

Best Hits

KEGG orthology group: None (inferred from 36% identity to ret:RHE_PE00198)

Predicted SEED Role

"polysaccharide biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E671 at UniProt or InterPro

Protein Sequence (497 amino acids)

>PGA1_262p00370 putative polysaccharide synthase (Phaeobacter inhibens DSM 17395)
MHDSNTDASTLSHVSRGRGRLALLGVFWSFVNIMVSNGLTVVVFLVTSLLLEPADFGAVA
LATSIVIWVMTLVPLPLGDAIIQRSDLRQAHLDSAFWLTMAIALASIAVLVISAPLIASW
TKLDVLAVILPVLSLRILFVSLGNIPAALVNRRMEFRHIALRTTLANGLGAAGCLLLVLQ
GYAIWALIMAQVITAVVGCIVSYWTADWRPGFQLSRAALTDLCGFTLFTMGGRMIEPTKI
NQILLGVVAGPAVLGIFFFARRICEILQELTIGTLLPVTRVLFASLQTEKDQRREAFILS
SFAAATAAFPLFIGFIIVAPTAIPFVFGSKWLAAIYPLQCFAMLSLMMSIGVMQASLVRF
SGHASWWFGFECVVSLSGFAAILLLAPEGLNRIMSALVGISFLLWPIATRKTLKILDMSA
ATYIFDALRPALISVSMMAIALFALRELGPPMYGTSQLLAQFAVAIPTYVIMIFLVGGDR
LQQILVQFRSRRNNSAQ