Protein Info for HP15_3572 in Marinobacter adhaerens HP15

Annotation: aminotransferase, classes I and II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR04350: putative C-S lyase" amino acids 5 to 394 (390 residues), 515.9 bits, see alignment E=3.1e-159 PF00155: Aminotran_1_2" amino acids 38 to 390 (353 residues), 139.6 bits, see alignment E=8e-45

Best Hits

Swiss-Prot: 41% identical to CBL_BACSU: Cystathionine beta-lyase PatB (patB) from Bacillus subtilis (strain 168)

KEGG orthology group: K14155, cystathione beta-lyase [EC: 4.4.1.8] (inferred from 76% identity to maq:Maqu_3806)

Predicted SEED Role

"Predicted dye-decolorizing peroxidase (DyP), encapsulated subgroup"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGM7 at UniProt or InterPro

Protein Sequence (401 amino acids)

>HP15_3572 aminotransferase, classes I and II (Marinobacter adhaerens HP15)
MSSPFDDPVSRENTCSVKFDARQAVFGTEEVIPVWVADMDFAAPEAVTRALAERAAHPIY
GYTLFPDSLYQSMIDWFANRHGWEIQREWILMAPGVVPSINAACMAYAGPGEGVIIQPPV
YPPFFSSVRHSGRVVIENPLVPEDPDTGDPGHYRMDLDHLEECAARPDARVLLLCSPHNP
VGRVWSEEELRAVLDIARRHQLVVVSDEIHCDLVFPDKPRHTMLANLAGPDDALVMAVAP
SKSFNMPGLGLSALVIPDAERRKAMKAVFESMHLPQCNPFSIAGFEAGYRHGGPWLDDLM
AYLQANRDYVVEAVGQRLPGVRVSAPEGTYLMWLDCRELGLDDAGLKRFFVRKAGVGMNP
GLSFGDPGSGFMRLNIGCPRSVLEEVIGRIEAALDRDLSDH