Protein Info for Psest_3695 in Pseudomonas stutzeri RCH2

Annotation: Histidine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF00221: Lyase_aromatic" amino acids 12 to 473 (462 residues), 531.6 bits, see alignment E=8.4e-164

Best Hits

Swiss-Prot: 35% identical to HUTH_XANAC: Histidine ammonia-lyase (hutH) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K01745, histidine ammonia-lyase [EC: 4.3.1.3] (inferred from 87% identity to pba:PSEBR_a451)

Predicted SEED Role

"Putative histidine ammonia-lyase protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQV4 at UniProt or InterPro

Protein Sequence (510 amino acids)

>Psest_3695 Histidine ammonia-lyase (Pseudomonas stutzeri RCH2)
MTEPVIFGENLLRIEDVLAVAQRRAPARLQADEAFRSRIARGAQFLDTLLDREGVIYGVT
TGYGDSCVVAVPLHQVEALPQHLFTFHGCGLGKLLEAEATRAVLAARLRSLTHGMSGVRI
ELLERMQAFLEHDVLPLIPEEGSVGASGDLTPLSYVAAALAGEREVLYRGERRSAAEVHR
QLGWTPLTLRPKEALALMNGTAVMTGLACLAYARADYLLQLATRITALNVIALQGNPEHF
DERLFAAKPHPGQTQVAAWIRQDLAIDAPAAPLHRLQDRYSIRCAPHVLGVLADSLGLLR
QFIETELNSANDNPIIDADNERVLHGGHFYGGHIAFAMDSLKNLVANVADLLDRQLALLV
DTRYNHGLPSNLSGAPAATAMINHGFKAVQIGTSAWTAEALKNSMPASVFSRSTECHNQD
KVSMGTIAARDALRSLELSEQVAAATLLAAQQGVWLRQRQEDARPLPAPLAAMHSELAET
FPPLIEDRALEGELRLCLAQIRNRHWRLYA