Protein Info for HP15_3564 in Marinobacter adhaerens HP15

Annotation: drug resistance transporter, Bcr/CflA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 47 to 67 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 249 to 268 (20 residues), see Phobius details amino acids 279 to 299 (21 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 369 to 389 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 10 to 387 (378 residues), 330.9 bits, see alignment E=7.2e-103 PF07690: MFS_1" amino acids 14 to 356 (343 residues), 165.9 bits, see alignment E=1.9e-52 PF06609: TRI12" amino acids 29 to 180 (152 residues), 33.6 bits, see alignment E=2.4e-12 PF00083: Sugar_tr" amino acids 44 to 109 (66 residues), 43.9 bits, see alignment E=2.4e-15

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 74% identity to maq:Maqu_3797)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGL9 at UniProt or InterPro

Protein Sequence (406 amino acids)

>HP15_3564 drug resistance transporter, Bcr/CflA subfamily (Marinobacter adhaerens HP15)
MLTLTSVWTTILLAAAVALGPLATDMYLPALPQIGSDFGTGTDQVQLTLSLYMVGFAIAQ
LICGPLADRFGRKPIMIGGFVLFAIASIGCALATNIETLILCRFLQALGGSAGPVLGRAA
IRDIYTPREAAKILAILASIMALAPAVAPTIGGLLTANLGWSSVFIALGGYALVMAVVVA
FGIPEPMRPEHRQSLKICSLLRNYRTIAKDISFVGYTLTNALIFSGLFAFLSGSSFVLID
FLGVPTEQFGLYFACMVAGYIVGNLTAVRLGRRLLPDQILVRGLIIAVGGGSLMAVLALS
EVFNVWAVILPQALFMIGTGMVLPQTMAGALANFPTMAGSASALFGFTQMAVAAIAGMLV
GHLHDGTSLVMASIIAACAAIAMGCYLLLVQRYPAKGFEPQSATGN