Protein Info for PGA1_262p00250 in Phaeobacter inhibens DSM 17395

Annotation: ferritin-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF00210: Ferritin" amino acids 18 to 156 (139 residues), 64.1 bits, see alignment E=7.2e-22

Best Hits

Swiss-Prot: 33% identical to G20U_BACSU: General stress protein 20U (dps) from Bacillus subtilis (strain 168)

KEGG orthology group: K04047, starvation-inducible DNA-binding protein (inferred from 83% identity to rde:RD1_0909)

Predicted SEED Role

"Non-specific DNA-binding protein Dps / Iron-binding ferritin-like antioxidant protein / Ferroxidase (EC 1.16.3.1)" in subsystem Oxidative stress (EC 1.16.3.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.16.3.1

Use Curated BLAST to search for 1.16.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F261 at UniProt or InterPro

Protein Sequence (157 amino acids)

>PGA1_262p00250 ferritin-like protein (Phaeobacter inhibens DSM 17395)
MTQTAAALSTDAKTAIADALNQSVAETAVTTMLAQNFHWNVKGMAFGPLHDLFQKIYEDH
FLGQDDLAERVRALDVHAEGTLAGMLKRSKVAEHDGHATDQEMIRIMMEAQETLASTLAG
CGALAADHGDTLTEDLCIARGQTHEKFAWFLRSHLAG