Protein Info for Psest_0363 in Pseudomonas stutzeri RCH2

Annotation: tripartite ATP-independent periplasmic transporter solute receptor, DctP family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03480: DctP" amino acids 30 to 307 (278 residues), 258.3 bits, see alignment E=4.7e-81 TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 37 to 284 (248 residues), 205.3 bits, see alignment E=5.4e-65

Best Hits

Swiss-Prot: 42% identical to DCTP1_POLSJ: Solute-binding protein Bpro_3107 (Bpro_3107) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: None (inferred from 92% identity to pmk:MDS_3628)

Predicted SEED Role

"TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI58 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Psest_0363 tripartite ATP-independent periplasmic transporter solute receptor, DctP family (Pseudomonas stutzeri RCH2)
MNLKRKLLVTALPFAFCISGLAHAMTLKIAEIHPAGYPTVVAMENLGKKLETATNGEIKS
RMFAGGVLGSEKEVIEQTQIGAVQLTRVSLGSVGPVVPATNVFNMPFVFRDIDHMRKVVD
GEIGQEILDAITNSDFNMVGLAWMEAGSRSLYTKKPIRRIEDLKGMKIRVIGNPLFIDTL
NAMGANGIAMDTGEIFSALQSGVIDGAENNSPTLLEHNHFRVAKHYTQTHHLILPEPLLM
SKDTWNKLSPEQQATVKKLAKEAQLEERDLWVAKETASNEKLKAEGVEFIEVDTKPFYDA
TAPVREKYGAQFAELIKRIEAVQ