Protein Info for Psest_3686 in Pseudomonas stutzeri RCH2

Annotation: Thioredoxin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF21352: Zn_ribbon_Thio2" amino acids 9 to 34 (26 residues), 41.4 bits, see alignment 2e-14 PF00085: Thioredoxin" amino acids 44 to 140 (97 residues), 85.1 bits, see alignment E=6.3e-28

Best Hits

KEGG orthology group: K03672, thioredoxin 2 [EC: 1.8.1.8] (inferred from 89% identity to psa:PST_0567)

Predicted SEED Role

"Thioredoxin" in subsystem Glycine reductase, sarcosine reductase and betaine reductase

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GN45 at UniProt or InterPro

Protein Sequence (145 amino acids)

>Psest_3686 Thioredoxin domain-containing protein (Pseudomonas stutzeri RCH2)
MTESLIIPCAHCASLNRIPVDRLQDAPRCGRCKAEALPNAPFDLQQSQFANQIKGDLPLL
VDVWASWCGPCRSFAPTFAQAASQLHGRCRLAKLDSEANAQLSTQLGIRSIPSLILFRNG
REVARQSGAMPLPQLMAWLAQQGIR