Protein Info for Psest_3684 in Pseudomonas stutzeri RCH2

Annotation: Di- and tricarboxylate transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 59 to 73 (15 residues), see Phobius details amino acids 97 to 127 (31 residues), see Phobius details amino acids 140 to 164 (25 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 403 to 433 (31 residues), see Phobius details amino acids 450 to 475 (26 residues), see Phobius details amino acids 480 to 500 (21 residues), see Phobius details amino acids 505 to 525 (21 residues), see Phobius details amino acids 532 to 551 (20 residues), see Phobius details amino acids 571 to 593 (23 residues), see Phobius details PF03600: CitMHS" amino acids 20 to 537 (518 residues), 262 bits, see alignment E=1.2e-81 PF02080: TrkA_C" amino acids 223 to 291 (69 residues), 44.7 bits, see alignment E=1.5e-15 amino acids 313 to 381 (69 residues), 42.4 bits, see alignment E=8.2e-15

Best Hits

KEGG orthology group: None (inferred from 97% identity to psa:PST_0569)

Predicted SEED Role

"TrkA domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQ78 at UniProt or InterPro

Protein Sequence (596 amino acids)

>Psest_3684 Di- and tricarboxylate transporters (Pseudomonas stutzeri RCH2)
MLPESLPLLFVCALLIWVLVAFVRESWSPDIVVAIAVAVLLATQLLTPGEVLGVLSNSAP
VTIACMFIISAALERTGCIDALGNWLGNLVGTSPTRVLFGLTITALVISACLNNTPVVAI
LTPVAISLAKRAGTTPSKLLIPLSYATILGGTLTMIGTSTNILVDGVARKAGLEPFGMFE
ITGAGLIMAAAGMVYLLTIGKHLLPERDTLSKLLGPRLDRNFMTELRVPPNSPVIGKTIA
EANLNGGSGLQVLQVNRDTQLFSRPEHDFTLTAGDLLMIHGQVKDVVELRESGHLTFNRG
DAFETISSEDVILAEAIVGRGSRYSHRPMRDLDLSARYGISVLAVHRQDENIQGNFDDFQ
LQFGDVMLVEGTPAQIKRFADNGELISLNAVQERAFRRDKAPIAIIATLAVMVLAAFGVM
PIEGLAIIGAASVLATRCLDVEDAYKAVDWKILSLIFGMLAISIAMDKVGLVQLIVQNVT
TLTPWAGPLFMLSFIYLLTSLLTEMLSNNAVAVLITPIAIGLAQHMGVDPRAFVVAVMFA
ASASFATPIGYQTNTFVYNAGGYRFTDFLKIGIPLNLLLWMVGTLVIPLFWPLTPL