Protein Info for HP15_3549 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 311 to 334 (24 residues), see Phobius details PF00672: HAMP" amino acids 336 to 383 (48 residues), 29.6 bits, see alignment 6.9e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 401 to 561 (161 residues), 151.8 bits, see alignment E=7.4e-49 PF00990: GGDEF" amino acids 406 to 558 (153 residues), 150.1 bits, see alignment E=5e-48

Best Hits

KEGG orthology group: None (inferred from 78% identity to maq:Maqu_3791)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PG49 at UniProt or InterPro

Protein Sequence (573 amino acids)

>HP15_3549 diguanylate cyclase (Marinobacter adhaerens HP15)
MSIKTRILGLAASLIVVASLASWLAYRELSENIIERWGQQVAEIQVRYDSARLLQSLERE
IGLAKQMASSSTLINWAASPDDETLKSEAIRQMESFRSNFRDNNYFVALVGNGHYYYNNA
ENEYAGSQFRYVLDEEKPDDAWFFQLIEEGRDFHLNVNPDTELGVTKLWIDVLMRDEAGE
IVGMVGTGLSLDAFLQDIVDIDQEGITTLFVDYNGAIQLYRDRNYIDFASIIKPEGQKNT
VDLLFEDPQDKQQILGMLQLLKKRGDQAGQVESGFVTVDGRKHLAGVAFLPAIGWFEITL
LDLHTLLPQSYLWPLVAVFLVTLLVSLLLFHFIIQSRILKPIMSLERAVEKVREGSFDLP
RLEKPNNEVGWLADHFEKMAQKLGQSTRELETKVAQRTDELNRLARIDPLTGLKNRRGLD
EILEEEIQRARRQDSGFGVIWLDIDHFKTINDNLGHQAGDQILCRVALWLKAGVRPYDHP
GRWGGDEFVVLLSPCDPDTLEQIARRIRELVEQESRKTGAAVTVSVGGFFARPGDTSDTI
LRHADRALYRAKAGGRNQVCIDTRDDETALSEN